Home  >  Products  >  anti-Topoisomerase (DNA) II alpha 170kDa (TOP2A) (C-Term) antibody
anti-Topoisomerase (DNA) II alpha 170kDa (TOP2A) (C-Term) antibody

anti-Topoisomerase (DNA) II alpha 170kDa (TOP2A) (C-Term) antibody

Cat no: ABIN184179

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Topoisomerase (DNA) II alpha 170kDa (TOP2A) (C-Term) antibody: This is a rabbit polyclonal antibody against TOP2A. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN184179
Reactivities: Human, Mouse, Rat, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 7153,480525,396917,21973,360243
Concentration: 1 mg/mL
Antigen: TOP2A
Clonality: Polyclonal
Sequence: VSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKY LEESDEDDLF
Molecular weight: 174 kDa
Entrez gene: 7153,480525,396917,21973,360243

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave