Home  >  Products  >  anti-Transcription Factor B1, Mitochondrial (TFB1M) (N-Term) antibody
anti-Transcription Factor B1, Mitochondrial (TFB1M) (N-Term) antibody

anti-Transcription Factor B1, Mitochondrial (TFB1M) (N-Term) antibody

Cat no: ABIN487132

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Transcription Factor B1, Mitochondrial (TFB1M) (N-Term) antibody: This is a rabbit polyclonal antibody against TFB1M. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN487132
Reactivities: Human, Bovine, Canine, Chicken/Bird, Porcine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 767802,379540,428608,51106,476253,100147809,533438
Concentration: 1 mg/mL
Antigen: TFB1M
Clonality: Polyclonal
Sequence: NFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGGITRSILN ADVAELLVVE
Molecular weight: 39 kDa
Entrez gene: 767802,379540,428608,51106,476253,100147809,533438

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave