Home  >  Products  >  anti-Transcription Factor-Like 5 (Basic Helix-Loop-Helix) (TCFL5) (Middle Region) antibody
anti-Transcription Factor-Like 5 (Basic Helix-Loop-Helix) (TCFL5) (Middle Region) antibody

anti-Transcription Factor-Like 5 (Basic Helix-Loop-Helix) (TCFL5) (Middle Region) antibody

Cat no: ABIN182376

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Transcription Factor-Like 5 (Basic Helix-Loop-Helix) (TCFL5) (Middle Region) antibody: This is a rabbit polyclonal antibody against TCFL5. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN182376
Reactivities: Human, Mouse
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 10732,277353
Concentration: 1 mg/mL
Antigen: TCFL5
Clonality: Polyclonal
Sequence: TLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYP LFTTNACSTS
Molecular weight: 53 kDa
Entrez gene: 10732,277353

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave