Home  >  Products  >  anti-Transforming Growth Factor beta 1 Induced Transcript 1 (TGFB1I1) (Middle Region) antibody

anti-Transforming Growth Factor beta 1 Induced Transcript 1 (TGFB1I1) (Middle Region) antibody

Cat no: ABIN182815


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Transforming Growth Factor beta 1 Induced Transcript 1 (TGFB1I1) (Middle Region) antibody: This is a rabbit polyclonal antibody against TGFB1I1. It was validated on Western Blot.
Catalogue number: ABIN182815
Reactivities: Human
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Accession: O43294
Gene: 7041
Concentration: 1 mg/mL
Antigen: TGFB1I1
Clonality: Polyclonal
Sequence: PEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPI AGQVVTALGR
Molecular weight: 48 kDa
Entrez gene: 7041

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave