Home  >  Products  >  anti-Transient Receptor Potential Cation Channel, Subfamily C, Member 4 (TRPC4) (Middle Region) antibody
anti-Transient Receptor Potential Cation Channel, Subfamily C, Member 4 (TRPC4) (Middle Region) antibody

anti-Transient Receptor Potential Cation Channel, Subfamily C, Member 4 (TRPC4) (Middle Region) antibody

Cat no: ABIN404985

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Transient Receptor Potential Cation Channel, Subfamily C, Member 4 (TRPC4) (Middle Region) antibody: This is a rabbit polyclonal antibody against TRPC4. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN404985
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 7223,486004,100157635,282102,22066,84494
Concentration: 1 mg/mL
Antigen: TRPC4
Clonality: Polyclonal
Sequence: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTV THEDYVTTRL
Molecular weight: 112 kDa
Entrez gene: 7223,486004,100157635,282102,22066,84494

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave