Home  >  Products  >  anti-Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2) (N-Term) antibody
anti-Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2) (N-Term) antibody

anti-Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2) (N-Term) antibody

Cat no: ABIN405646

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2) (N-Term) antibody: This is a rabbit polyclonal antibody against TRPM2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405646
Reactivities: Human, Mouse, Rat, Bovine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 7226,508029,28240,294329
Concentration: 1 mg/mL
Antigen: TRPM2
Clonality: Polyclonal
Sequence: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARS EIFMDEWQWK
Molecular weight: 171 kDa
Entrez gene: 7226,508029,28240,294329

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave