Home  >  Products  >  anti-Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3) (N-Term) antibody

anti-Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3) (N-Term) antibody

Cat no: ABIN183401


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3) (N-Term) antibody: This is a rabbit polyclonal antibody against TRPM3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183401
Reactivities: Human, Mouse
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 80036,226025
Concentration: 1 mg/mL
Antigen: TRPM3
Clonality: Polyclonal
Sequence: YLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESL RDQLLVTIQK
Molecular weight: 35 kDa
Entrez gene: 80036,226025

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave