Home  >  Products  >  anti-Transmembrane Protein 109 (TMEM109) (Middle Region) antibody
anti-Transmembrane Protein 109 (TMEM109) (Middle Region) antibody

anti-Transmembrane Protein 109 (TMEM109) (Middle Region) antibody

Cat no: ABIN311220

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Transmembrane Protein 109 (TMEM109) (Middle Region) antibody: This is a rabbit polyclonal antibody against TMEM109. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN311220
Reactivities: Human, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 79073,612355,540138,100008604
Concentration: 1 mg/mL
Antigen: TMEM109
Clonality: Polyclonal
Sequence: GIAAQLLNALGLAGDYLAQGLKLSPGQVQTFLLWGAGALV VYWLLSLLLG
Molecular weight: 26 kDa
Entrez gene: 79073,612355,540138,100008604

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave