Home  >  Products  >  anti-Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1) (Middle Region) antibody
anti-Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1) (Middle Region) antibody

anti-Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1) (Middle Region) antibody

Cat no: ABIN405580

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1) (Middle Region) antibody: This is a rabbit polyclonal antibody against TAP1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405580
Reactivities: Human, Mouse, Rat, Bovine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100329838,427727,6890,524959,21354,24811
Concentration: 1 mg/mL
Antigen: TAP1
Clonality: Polyclonal
Sequence: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLD RTPRCPPSGL
Molecular weight: 87 kDa
Entrez gene: 100329838,427727,6890,524959,21354,24811

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave