Home  >  Products  >  anti-Tumor Necrosis Factor Receptor Superfamily, Member 10a (TNFRSF10A) (C-Term) antibody
anti-Tumor Necrosis Factor Receptor Superfamily, Member 10a (TNFRSF10A) (C-Term) antibody

anti-Tumor Necrosis Factor Receptor Superfamily, Member 10a (TNFRSF10A) (C-Term) antibody

Cat no: ABIN1545522

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Tumor Necrosis Factor Receptor Superfamily, Member 10a (TNFRSF10A) (C-Term) antibody: This is a rabbit polyclonal antibody against TNFRSF10A. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN1545522
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Accession: O00220
Gene: 8797
Concentration: 1 mg/mL
Antigen: TNFRSF10A (tumor necrosis factor receptor superfamily, member 10a) (TNFRSF10A)
Clonality: Polyclonal
Sequence: RAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEE RHAKEKIQDL
Molecular weight: 50 kDa
Entrez gene: 8797

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave