Home  >  Products  >  anti-Tumor Necrosis Factor Receptor Superfamily, Member 11b (Osteoprotegerin) (TNFRSF11B) (N-Term) antibody
anti-Tumor Necrosis Factor Receptor Superfamily, Member 11b (Osteoprotegerin) (TNFRSF11B) (N-Term) antibody

anti-Tumor Necrosis Factor Receptor Superfamily, Member 11b (Osteoprotegerin) (TNFRSF11B) (N-Term) antibody

Cat no: ABIN184139

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Tumor Necrosis Factor Receptor Superfamily, Member 11b (Osteoprotegerin) (TNFRSF11B) (N-Term) antibody: This is a rabbit polyclonal antibody against TNFRSF11B. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN184139
Reactivities: Human, Mouse, Rat, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 690,482025,100049688,100348133,18383,25341
Concentration: 1 mg/mL
Antigen: TNFRSF11B
Clonality: Polyclonal
Sequence: LDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLK QHCTAKWKTV
Molecular weight: 46 kDa
Entrez gene: 690,482025,100049688,100348133,18383,25341

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave