Home  >  Products  >  anti-Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10) (Middle Region) antibody

anti-Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10) (Middle Region) antibody

Cat no: ABIN405656


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10) (Middle Region) antibody: This is a rabbit polyclonal antibody against UCRC. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405656
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Porcine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100137668,29796,100155687,616109,66152,685322
Concentration: 1 mg/mL
Antigen: UCRC
Clonality: Polyclonal
Sequence: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLW KHIKHKYENK
Molecular weight: 7 kDa
Entrez gene: 100137668,29796,100155687,616109,66152,685322

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave