Home  >  Products  >  anti-Ubiquinol-Cytochrome C Reductase, Rieske Iron-Sulfur Polypeptide 1 (UQCRFS1) (N-Term) antibody

anti-Ubiquinol-Cytochrome C Reductase, Rieske Iron-Sulfur Polypeptide 1 (UQCRFS1) (N-Term) antibody

Cat no: ABIN504495


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Ubiquinol-Cytochrome C Reductase, Rieske Iron-Sulfur Polypeptide 1 (UQCRFS1) (N-Term) antibody: This is a rabbit polyclonal antibody against UQCRFS1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN504495
Reactivities: Human, Mouse, Rat
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 7386,66694,291103
Concentration: 1 mg/mL
Antigen: UQCRFS1
Clonality: Polyclonal
Sequence: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQ PVLDLKRPFL
Molecular weight: 30 kDa
Entrez gene: 7386,66694,291103

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave