Home  >  Products  >  anti-Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2) (N-Term) antibody

anti-Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2) (N-Term) antibody

Cat no: ABIN183081


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2) (N-Term) antibody: This is a rabbit polyclonal antibody against UHRF2. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN183081
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 115426,474702,613759,109113,309331
Concentration: 1 mg/mL
Antigen: UHRF2
Clonality: Polyclonal
Sequence: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMN VKDLRPRART
Molecular weight: 90 kDa
Entrez gene: 115426,474702,613759,109113,309331

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave