Home  >  Products  >  anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6) (N-Term) antibody
anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6) (N-Term) antibody

anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6) (N-Term) antibody

Cat no: ABIN310859

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6) (N-Term) antibody: This is a rabbit polyclonal antibody against GALNT6. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN310859
Reactivities: Human, Mouse, Rat, Bovine, Canine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 100381149,11226,607787,506903,207839,100361647
Concentration: 1 mg/mL
Antigen: GALNT6
Clonality: Polyclonal
Sequence: MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELK PFWERPPQDP
Molecular weight: 71 kDa
Entrez gene: 100381149,11226,607787,506903,207839,100361647

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave