Home  >  Products  >  anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase-Like 1 (GALNTL1) (N-Term) antibody
anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase-Like 1 (GALNTL1) (N-Term) antibody

anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase-Like 1 (GALNTL1) (N-Term) antibody

Cat no: ABIN311200

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase-Like 1 (GALNTL1) (N-Term) antibody: This is a rabbit polyclonal antibody against GALNTL1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN311200
Reactivities: Human, Mouse, Rat, Bovine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100101309,57452,526331,108760,362760
Concentration: 1 mg/mL
Antigen: GALNTL1
Clonality: Polyclonal
Sequence: LSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSC PSVSYSSDLP
Molecular weight: 63 kDa
Entrez gene: 100101309,57452,526331,108760,362760

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave