Home  >  Products  >  anti-Unconventional SNARE in The ER 1 Homolog (S. Cerevisiae) (Use1) (N-Term) antibody

anti-Unconventional SNARE in The ER 1 Homolog (S. Cerevisiae) (Use1) (N-Term) antibody

Cat no: ABIN183481


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Unconventional SNARE in The ER 1 Homolog (S. Cerevisiae) (Use1) (N-Term) antibody: This is a rabbit polyclonal antibody against 2010315L10RIK. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183481
Reactivities: Mouse
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: Q9CQ56
Gene: 67023
Concentration: 1 mg/mL
Antigen: Use1
Clonality: Polyclonal
Sequence: MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDE WRLEKYVGAL
Molecular weight: 30 kDa
Entrez gene: 67023

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave