Home  >  Products  >  anti-V-Maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog A (Avian) (MAFA) (N-Term) antibody
anti-V-Maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog A (Avian) (MAFA) (N-Term) antibody

anti-V-Maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog A (Avian) (MAFA) (N-Term) antibody

Cat no: ABIN785379

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-V-Maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog A (Avian) (MAFA) (N-Term) antibody: This is a rabbit polyclonal antibody against MAFA. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN785379
Reactivities: Human, Mouse, Rat, Chicken/Bird, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100000492,395881,389692,378435,366949
Concentration: 1 mg/mL
Antigen: MAFA
Clonality: Polyclonal
Sequence: KPALEDLYWMSGYQHHLNPEALNLTPEDAVEALIGSGHHG AHHGAHHPAA
Molecular weight: 37 kDa
Entrez gene: 100000492,395881,389692,378435,366949

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave