Home  >  Products  >  anti-Vacuolar Protein Sorting 8 Homolog (S. Cerevisiae) (VPS8) (N-Term) antibody

anti-Vacuolar Protein Sorting 8 Homolog (S. Cerevisiae) (VPS8) (N-Term) antibody

Cat no: ABIN502325


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Vacuolar Protein Sorting 8 Homolog (S. Cerevisiae) (VPS8) (N-Term) antibody: This is a rabbit polyclonal antibody against VPS8. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502325
Reactivities: Human, Mouse, Rat, Bovine, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 791134,23355,615672,209018,287990
Concentration: 1 mg/mL
Antigen: VPS8
Clonality: Polyclonal
Sequence: CGFAKGQITMWDLASGKLLRSITDAHPPGTAILHIKFTDD PTLAICNDSG
Molecular weight: 162 kDa
Entrez gene: 791134,23355,615672,209018,287990

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave