Home  >  Products  >  anti-WD Repeat, Sterile alpha Motif and U-Box Domain Containing 1 (WDSUB1) (Middle Region) antibody

anti-WD Repeat, Sterile alpha Motif and U-Box Domain Containing 1 (WDSUB1) (Middle Region) antibody

Cat no: ABIN405561


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-WD Repeat, Sterile alpha Motif and U-Box Domain Containing 1 (WDSUB1) (Middle Region) antibody: This is a rabbit polyclonal antibody against WDSUB1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405561
Reactivities: Human, Mouse, Rat, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 777721,100127264,424331,151525,478761,72137,362137
Concentration: 1 mg/mL
Antigen: WDSUB1
Clonality: Polyclonal
Sequence: KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAME NWISKKKRTS
Molecular weight: 53 kDa
Entrez gene: 777721,100127264,424331,151525,478761,72137,362137

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave