Home  >  Products  >  anti-Wingless-Type MMTV Integration Site Family, Member 10B (WNT10B) (Middle Region) antibody

anti-Wingless-Type MMTV Integration Site Family, Member 10B (WNT10B) (Middle Region) antibody

Cat no: ABIN502078


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Wingless-Type MMTV Integration Site Family, Member 10B (WNT10B) (Middle Region) antibody: This is a rabbit polyclonal antibody against WNT10B. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502078
Reactivities: Human, Mouse, Rat, Canine, Porcine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 7480,486561,100126276,22410,315294
Concentration: 1 mg/mL
Antigen: WNT10B
Clonality: Polyclonal
Sequence: GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNR NSGAFQPRLR
Molecular weight: 40 kDa
Entrez gene: 7480,486561,100126276,22410,315294

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave