Home  >  Products  >  anti-Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) (Middle Region) antibody

anti-Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) (Middle Region) antibody

Cat no: ABIN405390


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) (Middle Region) antibody: This is a rabbit polyclonal antibody against WNT9B. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405390
Reactivities: Human, Mouse, Rat, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 7484,490919,22412,303586
Concentration: 1 mg/mL
Antigen: WNT9B
Clonality: Polyclonal
Sequence: CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRG NKDLRARADA
Molecular weight: 37 kDa
Entrez gene: 7484,490919,22412,303586

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave