Home  >  Products  >  anti-X-Prolyl Aminopeptidase (Aminopeptidase P) 2, Membrane-Bound (XPNPEP2) (Middle Region) antibody
anti-X-Prolyl Aminopeptidase (Aminopeptidase P) 2, Membrane-Bound (XPNPEP2) (Middle Region) antibody

anti-X-Prolyl Aminopeptidase (Aminopeptidase P) 2, Membrane-Bound (XPNPEP2) (Middle Region) antibody

Cat no: ABIN502132

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-X-Prolyl Aminopeptidase (Aminopeptidase P) 2, Membrane-Bound (XPNPEP2) (Middle Region) antibody: This is a rabbit polyclonal antibody against XPNPEP2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502132
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 7512,492124,445538,504822,170745,117522
Concentration: 1 mg/mL
Antigen: XPNPEP2
Clonality: Polyclonal
Sequence: QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIV DKFRGEEQFS
Molecular weight: 75 kDa
Entrez gene: 7512,492124,445538,504822,170745,117522

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave