Home  >  Products  >  anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC1) (Middle Region) antibody

anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC1) (Middle Region) antibody

Cat no: ABIN504496


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC1) (Middle Region) antibody: This is a rabbit polyclonal antibody against XRCC2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN504496
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 7516,475548,789410,57434,499966
Concentration: 1 mg/mL
Antigen: XRCC2
Clonality: Polyclonal
Sequence: CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKL VNDYRLVLFA
Molecular weight: 31 kDa
Entrez gene: 7516,475548,789410,57434,499966

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave