Home  >  Products  >  anti-YY1 Associated Factor 2 (YAF2) (Middle Region) antibody
anti-YY1 Associated Factor 2 (YAF2) (Middle Region) antibody

anti-YY1 Associated Factor 2 (YAF2) (Middle Region) antibody

Cat no: ABIN309607

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-YY1 Associated Factor 2 (YAF2) (Middle Region) antibody: This is a rabbit polyclonal antibody against YAF2. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN309607
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 100381052,417790,10138,609790,536696,67057,690262
Concentration: 1 mg/mL
Antigen: YAF2
Clonality: Polyclonal
Sequence: KGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKE KSEKETTSKK
Molecular weight: 20 kDa
Entrez gene: 100381052,417790,10138,609790,536696,67057,690262

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave