Home  >  Products  >  anti-Zinc Finger and BTB Domain Containing 48 (ZBTB48) (Middle Region) antibody

anti-Zinc Finger and BTB Domain Containing 48 (ZBTB48) (Middle Region) antibody

Cat no: ABIN504404


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Zinc Finger and BTB Domain Containing 48 (ZBTB48) (Middle Region) antibody: This is a rabbit polyclonal antibody against ZBTB48. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN504404
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100037240,419370,3104,608070,534608,100090,362668
Concentration: 1 mg/mL
Antigen: ZBTB48
Clonality: Polyclonal
Sequence: EFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFRTQAS LDKHNRTHTG
Molecular weight: 77 kDa
Entrez gene: 100037240,419370,3104,608070,534608,100090,362668

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave