Home  >  Products  >  anti-Zinc Finger and SCAN Domain Containing 18 (ZSCAN18) (N-Term) antibody

anti-Zinc Finger and SCAN Domain Containing 18 (ZSCAN18) (N-Term) antibody

Cat no: ABIN182774


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Zinc Finger and SCAN Domain Containing 18 (ZSCAN18) (N-Term) antibody: This is a rabbit polyclonal antibody against ZNF447. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN182774
Reactivities: Human, Rat, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Accession: Q8TBC5
Gene: 65982
Concentration: 1 mg/mL
Antigen: ZNF447
Clonality: Polyclonal
Sequence: PADLEFSRLRFREFVYQEAAGPHQTLARLHELCRQWLMPE ARSKEQMLEL
Molecular weight: 55 kDa
Entrez gene: 65982

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave