Home  >  Products  >  anti-Zinc Finger Protein 36, C3H Type, Homolog (Mouse) (ZFP36) (Middle Region) antibody

anti-Zinc Finger Protein 36, C3H Type, Homolog (Mouse) (ZFP36) (Middle Region) antibody

Cat no: ABIN501659


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Zinc Finger Protein 36, C3H Type, Homolog (Mouse) (ZFP36) (Middle Region) antibody: This is a rabbit polyclonal antibody against ZFP36. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501659
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 7538,484510,100316849,282127,67150,79426
Concentration: 1 mg/mL
Antigen: ZFP36
Clonality: Polyclonal
Sequence: PSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSS LGGSDSPVFE
Molecular weight: 34 kDa
Entrez gene: 7538,484510,100316849,282127,67150,79426

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave