Home  >  Products  >  anti-Zinc Finger Protein 442 (ZNF442) (Middle Region) antibody

anti-Zinc Finger Protein 442 (ZNF442) (Middle Region) antibody

Cat no: ABIN406668


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Zinc Finger Protein 442 (ZNF442) (Middle Region) antibody: This is a rabbit polyclonal antibody against ZNF442. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406668
Reactivities: Human, Mouse, Rat, Bovine, Canine, Drosophila/Arthropod, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: Q9H7R0
Gene: 79973
Concentration: 1 mg/mL
Antigen: ZNF442
Clonality: Polyclonal
Sequence: YLRHERTHTGEKPYECKHCSKAFPDYSSYVRHERTHTGEK PYKCKRCGRA
Molecular weight: 73 kDa
Entrez gene: 79973

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave