Home  >  Products  >  anti-Zinc Finger Protein 700 (ZNF700) (C-Term) antibody
anti-Zinc Finger Protein 700 (ZNF700) (C-Term) antibody

anti-Zinc Finger Protein 700 (ZNF700) (C-Term) antibody

Cat no: ABIN311352

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Zinc Finger Protein 700 (ZNF700) (C-Term) antibody: This is a rabbit polyclonal antibody against ZNF700. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN311352
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: Q9H0M5
Gene: 90592
Concentration: 1 mg/mL
Antigen: ZNF700
Clonality: Polyclonal
Sequence: CKECEKAFCKFSSFQIHERKHRGEKPYECKHCGNGFTSAK ILQIHARTHI
Molecular weight: 86 kDa
Entrez gene: 90592

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave