Home  >  Products  >  anti-Zinc Finger Protein 76 (Expressed in Testis) (ZNF76) (Middle Region) antibody

anti-Zinc Finger Protein 76 (Expressed in Testis) (ZNF76) (Middle Region) antibody

Cat no: ABIN309698


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Zinc Finger Protein 76 (Expressed in Testis) (ZNF76) (Middle Region) antibody: This is a rabbit polyclonal antibody against ZNF76. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN309698
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 7629,481754,100156228,100300346,224656,361809
Concentration: 1 mg/mL
Antigen: ZNF76
Clonality: Polyclonal
Sequence: MHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKR PRIAYLSEVK
Molecular weight: 62 kDa
Entrez gene: 7629,481754,100156228,100300346,224656,361809

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave