Home  >  Products  >  anti-Zinc Finger Protein 765 (ZNF765) (Middle Region) antibody
anti-Zinc Finger Protein 765 (ZNF765) (Middle Region) antibody

anti-Zinc Finger Protein 765 (ZNF765) (Middle Region) antibody

Cat no: ABIN406120

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Zinc Finger Protein 765 (ZNF765) (Middle Region) antibody: This is a rabbit polyclonal antibody against ZNF765. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406120
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Drosophila/Arthropod, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: Q7L2R6
Gene: 91661
Concentration: 1 mg/mL
Antigen: ZNF765
Clonality: Polyclonal
Sequence: CHRRLHTGEKPYKCEECDKAFHFKSKLQIHRRIHTGEKPY KCNECGKTFS
Molecular weight: 62 kDa
Entrez gene: 91661

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave