Quick Search
Products BAF53b
| Catalogue number: | 73-311, 75-311 |
| Reactivities: | Human, Mouse, Rat |
| Hosts: | Mouse |
| Applications: | Immunocytochemistry, Immunohistochemistry |
| Conjugates: | Unconjugated |
| Size: | 5 mL (TC supernatant), 100ul (pure) |
| Clone: | N332B/15 |
| Accession: | O94805 |
| Antigen: | Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b |
| Format: | TC Supe, Pure |
| P type: | Monoclonal |
| Target: | 53 kDa BRG1-associated factor B, BRG1-associated factor 53B, Actin-like protein 6B, ArpNalpha, ACTL6B and ACTL6 |
| Species: | Human |
| Isotype: | IgG1 |
Get the Best Promotions
