logo
logo
CA8, Recombinant, Human, His-Tag (Carbonic Anhydrase-related Protein, CARP, Carbonic Anhydrase VIII, CA-VIII, CALS)

Cat no: 137597

CA8, Recombinant, Human, His-Tag (Carbonic Anhydrase-related Protein, CARP, Carbonic Anhydrase VIII, CA-VIII, CALS)

CA8 was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, this protein lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). It continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. Defects in CA8 are the cause of cerebellar ataxia mental retardation and dysequilibrium syndrome type 3 (CMARQ3). Recombinant human CA8 protein fused to His-tag at N-terminal domain, was expressed in E.coli and purified by using conventional chromatography.\n\nSource:\nRecombinant protein corresponding to aa1-290 from human CA8, fused to His-tag at N-terminal domain, expressed in E.coli.\n\nMolecular Weight:\n~35.5kD (MALDI-TOF)\n\nAA Sequence:\nMGSSHHHHHHSSGLVPRGSHMGSHMADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVR FHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ\n\nStorage and Stability:\nMay be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Aliquots are stable for 6 months at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

137597

Size

100ug

Form

Supplied as a liquid in 20mM Tris-HCl, pH 8.0, 1mM DTT, 20% glycerol.

Purity

~90% (SDS-PAGE)

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...