Home  >  Products  >  Cdk8 (Cyclin-dependent Kinase 8, Cdk 8, Cell Division Protein Kinase 8, K35, Mediator Complex Subunit CDK8, MGC126074, MGC126075, Protein Kinase K35)
Cdk8 (Cyclin-dependent Kinase 8, Cdk 8, Cell Division Protein Kinase 8, K35, Mediator Complex Subunit CDK8, MGC126074, MGC126075, Protein Kinase K35)

Cdk8 (Cyclin-dependent Kinase 8, Cdk 8, Cell Division Protein Kinase 8, K35, Mediator Complex Subunit CDK8, MGC126074, MGC126075, Protein Kinase K35)

Cat no: C2578-05

Supplier: United States Biological
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-10ug/ml Optimal dilutions to be determined by the researcher. Hybridoma: Sp2/0 myeloma cells with spleen cells from Balb/c mice. Sequence: QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY Storage and Stability: May be stored at 4 degrees C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile 40-50% glycerol, aliquot and store at -20 degrees C. Aliquots are stable for at least 12 months at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Catalogue number: C2578-05
Reactivities: Human, Mouse, Rat
Hosts: Mouse
Applications: ELISA, Western Blot
Size: 100ug
Form: Supplied as a liquid in PBS, pH 7.2.
P type: Mab
Isotype: IgG1,k
Purity: Purified by Protein A affinity chromatography.
Alternative names: Cyclin Dependent Kinase 8
Additional info: Recognizes human Cdk8. Species Crossreactivity: mouse, rat.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
United States Biological
Get a Quote Direct from
United States Biological

By submitting this form you agree to your details being passed to United States Biological for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave