Applications:
Suitable for use in ELISA, Western Blot. Other applications not tested.
Recommended Dilution:
Western Blot: 0.1-10ug/ml
Optimal dilutions to be determined by the researcher.
Hybridoma:
Sp2/0 myeloma cells with spleen cells from Balb/c mice.
Sequence: QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Storage and Stability:
May be stored at 4 degrees C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile 40-50% glycerol, aliquot and store at -20 degrees C. Aliquots are stable for at least 12 months at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.