CEA-related cell adhesion molecule 6 (CEACAM6, NCA) belongs to the carcinoembryonic antigen (CEA) gene family. It encodes a glycosyl phosphatidyl inositol GPI)-linked glycoprotein with a Mr of 90kD which is strongly expressed on epithelial cells of the fetal and adult gastrointestinal tract, epithelia of glandular tissues, squamous epithelial cell of the tongue, esophagus and cervix as well as on granulocytes. CEACAM6 expression is upregulated in many adenocarcinomas and leukemias. Like all members of the CEA family, it consists of a single N domain, with structural homology to the immunoglobulin variable domains, followed by one immunoglobulin constant-like A and B domain.
Applications:
Suitable for use in Western Blot and Immunohistochemistry . Other applications not tested.
Recommended Dilutions:
Western Blot (Cell lysate):1:500-1:1000 detects a band at ~37.24kD using U-2 OS cells.
Western Blot (Transfected lysate): 1:1000-1:2000 detects a band at ~37.84kD using CEACAM6 transfected 293T lysate
Immunohistochemistry (Paraffin): 3ug/ml using human salivary gland tissue
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence:
MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Storage and Stability:
May be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Quick Search
Products 
