logo
logo
Ciliary Neurotropic Factor, Recombinant, Rat (CNTF)

Cat no: C5073-01A

Ciliary Neurotropic Factor, Recombinant, Rat (CNTF)

CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. CNTF is a survival factor for various neuronal cell types and seems to prevent the degeneration of motor axons after axotomy. CNTF Recombinant Rat produced in E. coli is a single, non-glycosylated polypeptide chain containing 200aa and having a molecular mass of 22834D. The CNTF is purified by proprietary chromatographic techniques.\n\nSource:\nRecombinant corresponding to rat CNTF expressed in E. coli.\n\nAA Sequence:\nAFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEM- TEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDG-GLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM\n\nMolecular Weight: \n~22.834kD\n\nBiological Activity: \nFully biologically active by its ability to phosphorylate STAT3 in several cells lines.\n\nStorage and Stability:\nLyophilized powder may be stored at -20 degrees C. Stable for 12 months at -20 degrees C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

C5073-01A

Size

20ug

Form

Supplied as a lyophilized powder from 0.025% sodium bicarbonate. Reconstitute in sterile dH2O or 0.4 % sodium bicarbonate adjusted to pH 8-9 to (same/more than)100ug/ml.

Purity

~99% (SDS-PAGE)

Read more on Supplier website
Advertisehere
MtoZ Horizontal banner
MtoZ Biolabs

Latest promotion FROM:

MtoZ Biolabs
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...