Cyan Fluorescent Protein, Recombinant (CFP)

The recombinant CFP (Cyan Fluorescent Protein) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal CFP fluorescence. Endotoxin has been removed, and the protein is suitable for cell culture applications. The protein is a 29kD monomer with 264aa, and an N-terminal His tag, Ex./Em.=458/480nm, Extinction coefficient: 26000M-1CM-1.\n\nApplications:\nSuitable for use as a control reagent for CFP expression studies or as a labeling reagent. Also suitable for use as standards for SDS-PAGE, Western blot of CFP transfected cells, label other proteins, calibration of fluorometers and flow cytometers, fluorescence microscope or microinjection of CFP into cells and tissues, etc. The recombinant CFP is ideal for fusion tag applications and is perfect for triple labeling with EGFP, RFP Cat #R1310-01B, or YFP, Cat #Y2043-01. Other applications not tested.\n\nRecommended Dilutions:\nOptimal dilutions to be determined by the researcher.\n\nAMINO ACID SEQUENCE:\nMSGGEELFAGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPV PWPTLVTTLAWGIQCFARYPEHMKMNDFFKSAMPEGYIQERTIHFQDDGKYKTRG EVKFEGDTLVNRVELKGEGFKEDGNILGHKLEYSAISDNVYIMPDKANNGLEANF KIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSCQSAISKDRNEARDHMVL LESFSAYCHTHGMDELYRSGLRSRAQASNSAVDGTAGPGSTGSR\nStorage and Stability:\nMay be stored at 4 degrees C for short-term only. For long-term storage, aliquot to avoid repeated freezing and thawing and freeze at -70 degrees C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts