Home  >  Products  >  Cystatin C (Cystatin-C, Cystatin-3, Gamma-trace, Neuroendocrine Basic Polypeptide, Post-gamma-globulin, CST3)

Cystatin C (Cystatin-C, Cystatin-3, Gamma-trace, Neuroendocrine Basic Polypeptide, Post-gamma-globulin, CST3)

Cat no: 125608


Supplier: United States Biological
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
A non-glycosylated secreted protein and member of the type 2 cystatin superfamily, which acts as a potent inhibitor of both endogenous and pathogenic cysteine proteinases. Cystatin C is produced by nucleated cells and is present in a variety of biological fluids. Changes in cystatin C have been associated with a number of cardiovascular diseases, including atherosclerosis and myocardial infarction, and measurement of plasma cystatin C levels can be used as a more sensitive marker than creatinine for determining glomerular filtration rate (GFR) in the kidneys. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA Storage and Stability: May be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Catalogue number: 125608
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100ug
Form: Supplied as a liquid in PBS, pH 7.2.
P type: Pab
Isotype: IgG
Purity: Purified by Protein A affinity chromatography.
Additional info: Recognizes human CST3.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
United States Biological
Get a Quote Direct from
United States Biological

By submitting this form you agree to your details being passed to United States Biological for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave