logo
logo
GFAP, Blocking Protein (Glial Fibrillary Acidic Protein)

Cat no: 136900

GFAP, Blocking Protein (Glial Fibrillary Acidic Protein)

Blocking Protein for G2032-27J.\n\nHuman GFAP is a 49.7kD protein (432aa) expressed in astrocytes. GFAP is an intermediate filament protein and acts as an intracellular structural component of the cytoskeleton. During embryonic and fetal life, GFAP is also expressed by radial glial cells of the CNS. Various mutations of the GFAP gene in humans produce Alexander's disease, one of the leukodystrophies. Antibodies to GFAP are therefore very useful as markers of astrocytic cells and neural stem cells. In addition many types of brain tumor, presumably derived from astrocytic cells, heavily express GFAP.\n\nSource:\nPurified Bovine GFAP protein\n\nAA Sequence:\nMERRRVTSATRRSYVSSSEMVVGGRRLGPG TRLSLARMPP PLPARVDFSLAGALNSGFKETRASERAEMM ELNDRFASYI EKVRFLEQQN KALAAELNQLRAKEPTKLAD VYQAELRELR LRLDQLTANS ARLEVERDNL AQDLGTLRQK LQDETNQRLE AENNLAAYRQ EADEATLARLDLERKIESLE EEIRFLRKIH EEEVRELQEQ LAQQQVHVEM DVAKPDLTAALREIRTQYEA VASSNMHEAE EWYRSKFADL NDAAARNAELLRQAKHEAND YRRQLQALTC DLESLRGTNESLERQMREQE ERHAREAASY QEALARLEEE GQSLKDEMAR HLQEYQDLLN VKLALDIEIA TYRKLLEGEE NRITIPVQTF SNLQIRETSL DTKSVSEGHL KRNIVVKTVE MRDGEVIKESKQEHKDVM\n\nMolecular Weight:\n~49.5kD\n\nApplications:\nSuitable for use in ELISA and Antibody Blocking. Other applications not tested.\n\nRecommended Dilution:\nOptimal dilutions to be determined by the researcher.\n\nStorage and Stability:\nMay be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

136900

Size

100ug

Form

Supplied as a liquid.

Purity

Serum

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...