logo
logo
GMFG, Recombinant, Human (GMF-gamma, Glia Maturation Factor, gamma)

Cat no: G2035-66A

GMFG, Recombinant, Human (GMF-gamma, Glia Maturation Factor, gamma)

GMFG is a hematopoietic-specific protein that mediates the pluripotentiality and lineage commitment of human hematopoietic stem cells. Glia maturation factor gamma is a cytokine-responsive protein in EPO-induced and G-CSF-induced hematopoietic lineage development. Glia maturation factor also acts as a Nerve Growth Factor in nervous system development, angiogenesis and immune function. GMFG possesses hematopoietic tissue-specific gene expression, a promoter concentrated with high-score hematopoiesis-specific transcription factors, and molecular coevolution with a rudimentary blood/immune system. Glia Maturation Factor-Gamma (GMF-Gamma) Human Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 142aa and having a total molecular mass of 16.8kD. Glia Maturation Factor-Gamma, GMF-Gamma, Human Recombinant is purified by proprietary chromatographic techniques.\n\nSource:\nRecombinant corresponding to human GMF-Gamma expressed in E. coli.\n\nAA Sequence: MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQP-RFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR\n\nMolecular Weight: \n~16.8kD\n\nStorage and Stability:\nMay be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

G2035-66A

Size

10ug

Form

Supplied as a liquid in 20mM Tris-HCl, pH-8, 1mM DTT, 1mM EDTA, 10% glycerol.

Purity

~90% (SDS-PAGE)

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...