Home  >  Products  >  HTR1E (5-hydroxytryptamine Receptor 1E, 5-HT-1E, 5-HT1E, S31, Serotonin Receptor 1E)

HTR1E (5-hydroxytryptamine Receptor 1E, 5-HT-1E, 5-HT1E, S31, Serotonin Receptor 1E)

Cat no: 128161


Supplier: United States Biological
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
5HT1E, a Serotonin Receptor, is not well studied. It is classified as an 5-HT1-like receptor because of its ligand-binding and effector-coupling characteristics. The human 5-HT1E receptor has been studied in an African green monkey kidney cell line, in which it modulated cAMP levels upon binding serotonin. Lack of structural variants in the human gene indicate a highly conserved protein. The 5-HT1E receptor has been reported to be expressed in human cortex, caudate, putamen, and amygdala, as well as in dorsal root ganglia and in coronary artery. ESTs have been isolated from human brain cancer libraries. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG Storage and Stability: May be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Catalogue number: 128161
Reactivities: Human
Hosts: Mouse
Applications: ELISA, Western Blot
Size: 100ug
Form: Supplied as a liquid in PBS, pH 7.2.
P type: Mab
Isotype: IgG2a,k
Purity: Purified by Protein A affinity chromatography.
Additional info: Recognizes human HTR1E.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
United States Biological
Get a Quote Direct from
United States Biological

By submitting this form you agree to your details being passed to United States Biological for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave