5HT1E, a Serotonin Receptor, is not well studied. It is classified as an 5-HT1-like receptor because of its ligand-binding and effector-coupling characteristics. The human 5-HT1E receptor has been studied in an African green monkey kidney cell line, in which it modulated cAMP levels upon binding serotonin. Lack of structural variants in the human gene indicate a highly conserved protein. The 5-HT1E receptor has been reported to be expressed in human cortex, caudate, putamen, and amygdala, as well as in dorsal root ganglia and in coronary artery. ESTs have been isolated from human brain cancer libraries.
Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence:
YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG
Storage and Stability:
May be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.