Home  >  Products  >  Human Glucagon like peptide 2 (GLP2) ELISA Kit
Human Glucagon like peptide 2 (GLP2) ELISA Kit

Human Glucagon like peptide 2 (GLP2) ELISA Kit

Cat no: KTE62531

Supplier: Abbkine Scientific Co.Ltd.
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy.
Catalogue number: KTE62531
Reactivities: Human
Applications: ELISA
Size: 48T, 96T, 96T*5, 96T*50
Additional info: Human Glucagon like peptide 2 (GLP2) ELISA Kit has high sensitivity and excellent specificity for detection of Human GLP2. No significant cross-reactivity or interference between Human GLP2 and analogues was observed.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Abbkine Scientific Co.Ltd.
Get a Quote Direct from
Abbkine Scientific Co.Ltd.

By submitting this form you agree to your details being passed to Abbkine Scientific Co.Ltd. for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave