IgG2a, Murine Isotype Control, Recombinant (Biotin)

Recombinant muIg control protein was engineered to be a negative control for murine IgG2a Fc\ncontaining fusion proteins. \n\nPredicted non glycosylated monomeric molecular weight: 27.8kD. In SDS-PAGE, the protein migrates at ~55kD non reduced, and ~30kD reduced.\n\nTransfectant Cell Line: CHO\nA soluble fusion protein consisting of residual murine CD8 signal peptide and linker: (1)kpqapelrgsagt(13)\n\nfused to murine IgG2a Fc and hinge regions: (14)eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk(246)\n\nApplications:\nSuitable for use in ELISA. Other applications not tested.\n\nRecommended Dilution:\nOptimal dilutions to be determined by the researcher.\n\nStorage and Stability:\nMay be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

I1904-83F4

Size

25ug

Conjugates

Biotin

Form

Supplied as a liquid in 50mM sodium phosphate, pH 7.5, 100mM potassium chloride, 150mM sodium chloride, 0.2% BSA, 0.04% sodium azide, 5% glycerol. Labeled with Biotin.

Purity

Purified by size exclusion.