MCP2, Recombinant, Human (Macrophage/Monocyte Chemotactic Protein 2, Chemokine C-C Motif Ligand 8, CCL8, HC14, Monocyte Chemotactic Protein 2, Small Inducible Cytokine A8 Precursor, SCYA8, SCYA10)

MCP-2 and MCP-3 are two recently identified monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the C-C family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1. MCP-3 also shares 58% amino acid identity with MCP-2.\nSimilarly to other C-C chemokines, all three MCP proteins are monocyte chemoattractants. In addition, the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes. All three cytokines have also been shown to attract eosinophils and induce histamine secretion from basophils.\n\nBiological Activity: \nFully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood monocytes using a concentration range of 10.0 -100.0 ng/ml.\n\nAA Sequence: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCAD\nPKERWVRDSMKHLDQIFQNLKP\n\nEndotoxin: (same/less than)1EU/ug as determined by LAL method.\n\nStorage and Stability:\nAliquot to avoid repeated freezing and thawing and freeze at -70 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

M2750-11D

Size

2ug

Form

Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml.

Purity

~96% by SDS-PAGE and HPLC analyses.