Home  >  Products  >  MECOM (MDS1 and EVI1 Complex Locus Protein MDS1, Myelodysplasia Syndrome 1 Protein, Myelodysplasia Syndrome-associated Protein 1, MDS1)

MECOM (MDS1 and EVI1 Complex Locus Protein MDS1, Myelodysplasia Syndrome 1 Protein, Myelodysplasia Syndrome-associated Protein 1, MDS1)

Cat no: 129531


Supplier: United States Biological
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
A chromosomal aberration involving MDS1 is found in a form of acute myeloid leukemia (AML). Translocation t(3;21) with AML1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWLYLGKRSSDVGIAFSQADVYMPGLQCAFLS Storage and Stability: May be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Catalogue number: 129531
Reactivities: Human
Hosts: Mouse
Applications: ELISA, Western Blot
Size: 100ug
Form: Supplied as a liquid in PBS, pH 7.2.
P type: Mab
Isotype: IgG2b,k
Purity: Purified by Protein A affinity chromatography.
Additional info: Recognizes human MDS1.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
United States Biological
Get a Quote Direct from
United States Biological

By submitting this form you agree to your details being passed to United States Biological for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave