Neuregulin 1, Recombinant, Human (NRG1, NDF)

Neuregulin is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells, playing an important role in heart structure and function through inducing ErbB2/ErbB4 receptor phosphorylation and cardiomyocyte differentiation. Research on molecular level discovered that recombinant neuregulin could make disturbed myocardial cell structure into order and strengthen the connection between myocardial cells by intercalated discs re-organization. Pharmacodynamic experiments in animals showed that recombinant neuregulin (NRG1) can reduce the degree of damage on myocardial cells caused by ischemia, hypoxia and viral infection.\n\nDescription: \nRecombinant Human Neuroregulin-1 (Neu differentiation factor) produced in E. coli is a single, non-glycosylated polypeptide chain containing 61 amino acids having a molecular mass of 7055D. Recombinant Human NRG1 is purified by proprietary chromatographic techniques.\n\nAmino Acid Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ\n\nBiological Activity: \nThe activity measured by its ability to stimulate the proliferation of human MCF-7 cells grown under serum-free conditions corresponding to a specific activity of 1.2x10e4 units/mg.\n\nStorage and Stability: \nLyophilized powder may be stored at -20 degrees C. Stable for 12 months at -20 degrees C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

N2108-75

Size

10ug

Form

Supplied as a lyophilized powder from 20mM phosphate buffer, pH 7.4, 150mM sodium chloride. Reconstitute with sterile ddH2O, to a concentration of (same/more than)100ug/ml.

Purity

(same/more than) 95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel.

References

1. Tangential neuronal migration controls axon guidance: a role for neuregulin-1 in thalamocortical axon navigation. Cell 2006 Apr 7;125(1):127-42. 2. Neuregulin 1-erbB signaling is necessary for normal myelination and sensory function. J Neurosci 2006 Mar 22;26(12):3079-86. 3. Constitutive neuregulin-1/ErbB signaling contributes to human vestibular schwannoma proliferation. Glia 2006 Apr 15;53(6):593-600. 4. Sexually dimorphic changes in the exploratory and habituation profiles of heterozygous neuregulin-1 knockout mice. Neuroreport 2006 Jan 23;17(1):79-83. 5. Analysis of polymorphisms in AT-rich domains of neuregulin 1 gene in schizophrenia. Am J Med Genet B Neuropsychiatr Genet 2006 Jan 5;141(1):102-9. 6. Evidence that interaction between neuregulin 1 and its receptor erbB4 increases susceptibility to schizophrenia. Am J Med Genet B Neuropsychiatr Genet 2006 Jan 5;141(1):96-101.