Paraoxonase 2, Recombinant, Human (PON2, Serum paraoxonase arylesterase 2, A-esterase 2, Aromatic esterase 2)

Paraoxonase 2 (PON2) is a member of a multigene family whose genes share 65% identity at the amino acid level, and is expressed in a variety of tissues, including the pancreas. PON2 overexpression has been shown to lower the intracellular oxidative state and reduce the cells ability to oxidize LDL. PON2 is therefore implicated in the modulation of oxidative stress.\n\nRecombinant Human Paraoxonase-2 is expressed in E. coli having a molecular weight of 43.5kD and fused to an amino terminal hexahistidine tag.\n\nApplications:\nSuitable for use as a positive control in Western Blot, ELISA, Immunoprecipitation and other immunological experiments. Other applications not tested\n\nRecommended Dilutions:\nOptimal dilutions to be determined by the researcher.\n\nAmino Acid Sequence:\nMGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDID ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVY DGKLLIGTLYHRALYCELZ.\n\nStorage and Stability:\nMay be stored at 4 degrees C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Aliquots are stable for 6 months at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

P3107-78

Size

2ug

Form

Supplied as a liquid in PBS, 50% glycerol.

Purity

~95% (SDS-PAGE). Single band on Western Blot.

References

1. Relationship between paraoxonase 1 55 Met/Leu, paraoxonase 2 148 Ala/Gly genetic polymorphisms and coronary artery disease. Zhonghua Yi Xue Yi Chuan Xue Za Zhi 2006 Jun;23(3):289-93 2. The araoxonase-2-310 polymorphism is associated with the presence of microvascular omplications in diabetes mellitus. J Intern Med 2005 Oct;258(4):363-8 3. Genetic polymorphism of pyruvate dehydrogenase kinase 4 (PDK4), paraoxonase 2 (PON2), and fatty acid binding protein 2 (FABP2) in the NIDDM population of Senegal. Dakar Med 2002;47(1):18-21 4. Paraoxonase 2 (PON2) expression is upregulated via a reduced-nicotinamide-adenine-dinucleotide-phosphate (NADPH)-oxidase-dependent mechanism during monocytes differentiation into macrophages. Free Radic Biol Med 2004 Dec 15;37(12):2052-63 5. Possible association between Cys311Ser polymorphism of paraoxonase 2 gene and late-onset Alzheimer's disease in Chinese. Brain Res Mol Brain Res 2004 Jan 5;120(2):201-4 6. Decreased macrophage paraoxonase 2 expression in patients with hypercholesterolemia is the result of their increased cellular cholesterol content: effect of atorvastatin therapy. Arterioscler Thromb Vasc Biol 2004 Jan;24(1):175-80