logo
logo
Protein G, Recombinant

Cat no: P9102-45

Protein G, Recombinant

Protein G lacking the albumin binding region (avoids undesirable reactions with albumin); Fc binding domain is still present. \n\nEach Protein G molecule can bind 2 molecules of IgG, allowing the formation of a precipitate. \n\nProtein G is a small globular cell surface protein produced by Streptococcus sp. It is composed of two or three nearly identical domains of 55 amino acids each. It binds to Fc fragment of IgG with high affinity. Protein G will bind IgGs from many species including all human and mouse subclasses. It does not recognize IgM, IgA, IgE or serum albumin. Protein G binds IgG from rat,, but substantially more weakly than IgG from other species.\n\nRecombinant Protein G is a highly stable surface receptor from Streptococcus sp. Lancefield Group G, produced in Escherichia coli, which is capable of binding the Fc portion of immunoglobulins, especially IgGs, from a large number of species (Boyle and Reis, 1987).\n\nProtein G may be coupled to a wide variety of reporter molecules including fluorescent dyes, enzyme markers, biotin, colloidal gold and radioactive iodine without affecting the antibody binding site. These conjugates may be used to track immunoglobulins in histochemical, western and ELISA applications. \n\nAlternatively, Protein G may be immobilized onto a solid support to facilitate the purification and recovery of either polyclonal or monoclonal immunoglobulins. \n\nApplications:\nSuitable for use in Immunologically active enzyme conjugates, ELISA, Western blot, Affinity purification of polyclonal and monoclonal antibodies and Immunoprecipitation. Other applications not tested.\n\nActivity:\n(same/more than)95% human IgG binding\n\nMolecular Weight:\n22.6kD. Apparent weight by SDS PAGE is 32kD\n\nExtinction Coefficient: E280(1%) = ~9.5 \n\nStability: pH: 2-10\n\nTemperature: 80 degrees C for 10 min at pH 7.0\n\nIsoelectric Point: \npH 4\n\nAmino Acid Sequence:\nMTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE\n\nStorage and Stability:\nLyophilized powder may be stored at -20 degrees C. Stable for 12 months at -20 degrees C. Reconstitute with sterile ddH2O. Aliquot and store at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

P9102-45

Size

1mg

Applications

ELISA, IP, WB

Form

Supplied as a lyophilized powder with no additives. Reconstitute 5mg with 240ul sterile ddH2O.

Purity

(same/more than)95% as determined by SDS-PAGE and RP-HPLC

References

1. Boyle, M.D.P. & Reis, K.J., Biotechnology 5: 697-703 (1987). 2. Fahnestock, S.R., et al., J. Bacteriology 167: 870-877 (1986). 3. Fahnestock, S.R., Trends Biotechnology 5: 79-84 (1987).

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...