logo
logo
Rac1, Recombinant, Human

Cat no: R0400-01

Rac1, Recombinant, Human

Rac1, a member of Ras small G-proteins, is involved in cytoskeletal actin organization as well as transformation. It is also involved in stress-induced JNKK signal transduction pathway. Rac1, belonging to the Rho small GTPase family, regulates the actin cytoskeleton but also other cellular processes. RAC1 has been shown to be involved in the regulation of cell-cell adhesion. \n\nSequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTA\nGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDL\nRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP\nPPVKKRKRKCLLL\n\nStorage and Stability:\nMay be stored at 4 degrees C for short-term only. For long-term storage, aliquot and store at -20 degrees C. Aliquots are stable for at least 6 months at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

R0400-01

Size

100ug

Form

Supplied as liquid in 20mM Tris-HCl, pH 7.5, 2mM EDTA, 1mM DTT.

Purity

Chromatographically purified (same/more than) 95% by SDS-PAGE

References

1. Kjoller, L., et al., J. Biol. Chem. 152: 1145-1168 (2001). 2. Diakonova, M., et al., J. Biol. Chem. 277: 10,669-10,677 (2002). 3. Kovacic, H., et al., J. Biol. Chem. 276: 45,856-45,861 (2001). 4. Chrostek A et al.,(2006) Mol Cell Biol.26(18):6957-70 5. Sun CX et al., (2004) Blood. 104(12):3758-65

Read more on Supplier website
Advertisehere
MtoZ Horizontal banner
MtoZ Biolabs

Latest promotion FROM:

MtoZ Biolabs
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...